Lineage for d2fxb__ (2fxb -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32367Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 32432Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (3 proteins)
  6. 32437Protein Ferredoxin [54882] (1 species)
  7. 32438Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (1 PDB entry)
  8. 32439Domain d2fxb__: 2fxb - [38997]

Details for d2fxb__

PDB Entry: 2fxb (more details), 2.3 Å

PDB Description: structure of (4*fe-4*s) ferredoxin from bacillus $thermoproteolyticus refined at 2.3 angstroms resolution. structural comparisons of bacterial ferredoxins

SCOP Domain Sequences for d2fxb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxb__ d.58.1.4 (-) Ferredoxin {Bacillus thermoproteolyticus}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

SCOP Domain Coordinates for d2fxb__:

Click to download the PDB-style file with coordinates for d2fxb__.
(The format of our PDB-style files is described here.)

Timeline for d2fxb__: