Lineage for d1daxa_ (1dax A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906385Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 1906404Protein Ferredoxin I [54880] (2 species)
  7. 1906405Species Desulfovibrio africanus [TaxId:873] [54881] (3 PDB entries)
  8. 1906408Domain d1daxa_: 1dax A: [38996]
    complexed with sf4

Details for d1daxa_

PDB Entry: 1dax (more details)

PDB Description: oxidised desulfovibrio africanus ferredoxin i, nmr, minimized average structure
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1daxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1daxa_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio africanus [TaxId: 873]}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

SCOPe Domain Coordinates for d1daxa_:

Click to download the PDB-style file with coordinates for d1daxa_.
(The format of our PDB-style files is described here.)

Timeline for d1daxa_: