Lineage for d1dfda_ (1dfd A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861077Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 861096Protein Ferredoxin I [54880] (2 species)
  7. 861100Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)
  8. 861103Domain d1dfda_: 1dfd A: [38995]
    complexed with fs4

Details for d1dfda_

PDB Entry: 1dfd (more details)

PDB Description: oxidised desulfovibrio africanus ferredoxin i, nmr, 19 structures
PDB Compounds: (A:) ferredoxin I

SCOP Domain Sequences for d1dfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfda_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

SCOP Domain Coordinates for d1dfda_:

Click to download the PDB-style file with coordinates for d1dfda_.
(The format of our PDB-style files is described here.)

Timeline for d1dfda_: