Lineage for d1dfda_ (1dfd A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723447Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 723466Protein Ferredoxin I [54880] (2 species)
  7. 723470Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)
  8. 723473Domain d1dfda_: 1dfd A: [38995]
    complexed with fs4

Details for d1dfda_

PDB Entry: 1dfd (more details)

PDB Description: oxidised desulfovibrio africanus ferredoxin i, nmr, 19 structures
PDB Compounds: (A:) ferredoxin I

SCOP Domain Sequences for d1dfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfda_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

SCOP Domain Coordinates for d1dfda_:

Click to download the PDB-style file with coordinates for d1dfda_.
(The format of our PDB-style files is described here.)

Timeline for d1dfda_: