SCOP 1.73: Domain d1dfda_: 1dfd A:

Lineage for d1dfda_ (1dfd A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
   contains only one 4Fe-4S cluster

6. Protein Ferredoxin I [54880] (2 species)

7. Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)

8. Domain d1dfda_: 1dfd A: [38995]
   complexed with fs4

Details for d1dfda_

PDB Entry: 1dfd

PDB Description: oxidised desulfovibrio africanus ferredoxin i, nmr, 19 structures

PDB Compounds: (A:) ferredoxin I

SCOP Domain Sequences for d1dfda_:

Sequence; same for both SEQRES and ATOM records:

>d1dfda_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

Timeline for d1dfda_:

• d1dfda_ first appeared (with stable ids) in SCOP 1.55, called d1dfd__
  
• d1dfda_ was called d1dfd__ in SCOP 1.71
  
• d1dfda_ appears in SCOP 1.75
  
• d1dfda_ appears in the current release, SCOPe 2.08