Lineage for d1dfd__ (1dfd -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins) 
Protein Ferredoxin I [54880] (1 species) Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries) 
Domain d1dfd__: 1dfd - [38995]
Details for d1dfd__
PDB Entry: 1dfd (more details)
PDB Description: oxidised desulfovibrio africanus ferredoxin i, nmr, 19 structures
SCOP Domain Sequences for d1dfd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfd__ d.58.1.4 (-) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede
SCOP Domain Coordinates for d1dfd__:
Click to download the PDB-style file with coordinates for d1dfd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dfd__:
- d1dfd__ first appeared (with stable ids) in SCOP 1.55
- d1dfd__ appears in SCOP 1.59
- d1dfd__ appears in the current release, SCOPe 2.08, called d1dfda_
View in 3D