Lineage for d7cjub_ (7cju B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722149Protein automated matches [196672] (8 species)
    not a true protein
  7. 2722150Species Bacillus sp. [TaxId:1806516] [389941] (1 PDB entry)
  8. 2722152Domain d7cjub_: 7cju B: [389943]
    automated match to d1v5da_

Details for d7cjub_

PDB Entry: 7cju (more details), 1.74 Å

PDB Description: crystal structure of inactive form of chitosanase crystallized by ammonium sulfate
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d7cjub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjub_ a.102.1.2 (B:) automated matches {Bacillus sp. [TaxId: 1806516]}
kemkpfpqqvnyagvikpnhvtqeslnasvrsyydnwkkkylkndlsslpggyyvkgeit
gdadgfkplgtsegqgygmiitvlmagydsnaqkiydglfktartfkssqnpnlmgwvva
dskkaqghfdsatdgdldiayslllahkqwgsngtvnylkeaqdmitkgikasnvtnnnq
lnlgdwdskssldtrpsdwmmshlrafyeftgdktwltvinnlydvytqfsnkyspntgl
isdfvvknppqpapkdfldeseytnayyynasrvplrivmdyamygekrskvisdkvssw
iqnktngnpskivdgyqlngsnigsyptavfvspfiaasitssnnqkwvnsgwdwmknkr
eryfsdsynlltmlfitgnwwkpvpddt

SCOPe Domain Coordinates for d7cjub_:

Click to download the PDB-style file with coordinates for d7cjub_.
(The format of our PDB-style files is described here.)

Timeline for d7cjub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7cjua_