Lineage for d1fxrb_ (1fxr B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 191936Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 192003Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
  6. 192012Protein Ferredoxin I [54880] (1 species)
  7. 192013Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)
  8. 192015Domain d1fxrb_: 1fxr B: [38994]

Details for d1fxrb_

PDB Entry: 1fxr (more details), 2.3 Å

PDB Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution

SCOP Domain Sequences for d1fxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxrb_ d.58.1.4 (B:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

SCOP Domain Coordinates for d1fxrb_:

Click to download the PDB-style file with coordinates for d1fxrb_.
(The format of our PDB-style files is described here.)

Timeline for d1fxrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fxra_