SCOP 1.59: Domain d1fxrb_: 1fxr B:

Lineage for d1fxrb_ (1fxr B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)

6. Protein Ferredoxin I [54880] (1 species)

7. Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)

8. Domain d1fxrb_: 1fxr B: [38994]

Details for d1fxrb_

PDB Entry: 1fxr, 2.3 Å

PDB Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution

SCOP Domain Sequences for d1fxrb_:

Sequence; same for both SEQRES and ATOM records:

>d1fxrb_ d.58.1.4 (B:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

Timeline for d1fxrb_:

• d1fxrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxrb_ appears in SCOP 1.57
  
• d1fxrb_ appears in SCOP 1.61
  
• d1fxrb_ appears in the current release, SCOPe 2.08