SCOPe 2.08: Domain d1fxrb_: 1fxr B:

Lineage for d1fxrb_ (1fxr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
   contains only one 4Fe-4S cluster
   automatically mapped to Pfam PF13459
   automatically mapped to Pfam PF13370

6. Protein Ferredoxin I [54880] (2 species)

7. Species Desulfovibrio africanus [TaxId:873] [54881] (3 PDB entries)

8. Domain d1fxrb_: 1fxr B: [38994]
   complexed with sf4, so4

Details for d1fxrb_

PDB Entry: 1fxr, 2.3 Å

PDB Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution

PDB Compounds: (B:) ferredoxin I

SCOPe Domain Sequences for d1fxrb_:

Sequence; same for both SEQRES and ATOM records:

>d1fxrb_ d.58.1.4 (B:) Ferredoxin I {Desulfovibrio africanus [TaxId: 873]}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

Timeline for d1fxrb_:

• d1fxrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxrb_ appears in SCOPe 2.07