SCOPe 2.08: Domain d7chcb1: 7chc B:1-111

Lineage for d7chcb1 (7chc B:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7chcb1: 7chc B:1-111 [389939]
   Other proteins in same PDB: d7chca_, d7chcb2, d7chch_, d7chcl1, d7chcl2, d7chcr_
   automated match to d1dn0a1

Details for d7chcb1

PDB Entry: 7chc, 2.71 Å

PDB Description: crystal structure of the sars-cov-2 s rbd in complex with bd-629 fab and bd-368-2 fab

PDB Compounds: (B:) BD-368-2 Fab L

SCOPe Domain Sequences for d7chcb1:

Sequence; same for both SEQRES and ATOM records:

>d7chcb1 b.1.1.0 (B:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqsllhsngynyldwylqkpgqspqlliylgsnra
sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpgtfgqgtrlei

Timeline for d7chcb1:

• d7chcb1 first appeared in SCOPe 2.07