Lineage for d1fxra_ (1fxr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192764Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 2192783Protein Ferredoxin I [54880] (2 species)
  7. 2192784Species Desulfovibrio africanus [TaxId:873] [54881] (3 PDB entries)
  8. 2192785Domain d1fxra_: 1fxr A: [38993]
    complexed with sf4, so4

Details for d1fxra_

PDB Entry: 1fxr (more details), 2.3 Å

PDB Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1fxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio africanus [TaxId: 873]}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

SCOPe Domain Coordinates for d1fxra_:

Click to download the PDB-style file with coordinates for d1fxra_.
(The format of our PDB-style files is described here.)

Timeline for d1fxra_:

2192785
d1fxra_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1fxrb_