Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster |
Protein Ferredoxin I [54880] (2 species) |
Species Desulfovibrio africanus [TaxId:873] [54881] (3 PDB entries) |
Domain d1fxra_: 1fxr A: [38993] complexed with sf4, so4 |
PDB Entry: 1fxr (more details), 2.3 Å
SCOPe Domain Sequences for d1fxra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio africanus [TaxId: 873]} arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih wede
Timeline for d1fxra_: