SCOP 1.63: Domain d1fxra_: 1fxr A:

Lineage for d1fxra_ (1fxr A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
   contains only one 4Fe-4S cluster

6. Protein Ferredoxin I [54880] (1 species)

7. Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)

8. Domain d1fxra_: 1fxr A: [38993]

Details for d1fxra_

PDB Entry: 1fxr, 2.3 Å

PDB Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution

SCOP Domain Sequences for d1fxra_:

Sequence; same for both SEQRES and ATOM records:

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

Timeline for d1fxra_:

• d1fxra_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxra_ appears in SCOP 1.61
  
• d1fxra_ appears in SCOP 1.65
  
• d1fxra_ appears in the current release, SCOPe 2.08