Lineage for d1fxra_ (1fxr A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133320Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 133387Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
  6. 133396Protein Ferredoxin I [54880] (1 species)
  7. 133397Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)
  8. 133398Domain d1fxra_: 1fxr A: [38993]

Details for d1fxra_

PDB Entry: 1fxr (more details), 2.3 Å

PDB Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution

SCOP Domain Sequences for d1fxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

SCOP Domain Coordinates for d1fxra_:

Click to download the PDB-style file with coordinates for d1fxra_.
(The format of our PDB-style files is described here.)

Timeline for d1fxra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fxrb_