Lineage for d1fxra_ (1fxr A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (3 proteins) 
Protein Ferredoxin I [54880] (1 species) Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries) 
Domain d1fxra_: 1fxr A: [38993]
Details for d1fxra_
PDB Entry: 1fxr (more details), 2.3 Å
PDB Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution
SCOP Domain Sequences for d1fxra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede
SCOP Domain Coordinates for d1fxra_:
Click to download the PDB-style file with coordinates for d1fxra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fxra_:
- d1fxra_ appears in SCOP 1.57
- d1fxra_ appears in the current release, SCOPe 2.08
View in 3D
