Lineage for d7c90a_ (7c90 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305121Species Methylophaga aminisulfidivorans [TaxId:1026882] [389919] (1 PDB entry)
  8. 2305122Domain d7c90a_: 7c90 A: [389927]
    automated match to d2gc7d_
    complexed with ca, epe, fe, gol, hec, na

Details for d7c90a_

PDB Entry: 7c90 (more details), 2.13 Å

PDB Description: crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl)
PDB Compounds: (A:) Cytochrome c, mono-and diheme variant

SCOPe Domain Sequences for d7c90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c90a_ a.3.1.0 (A:) automated matches {Methylophaga aminisulfidivorans [TaxId: 1026882]}
qlvfrntvtgdvldlsfgkkgekteavehflntgenlyntddeaikageslfmtacsgch
ghhaegklgpalgddyytypknandkglfetiyggarsmmgpqynnltkdeilhimawvr
svywgsadkadwlteeqkanfkpaevpedfk

SCOPe Domain Coordinates for d7c90a_:

Click to download the PDB-style file with coordinates for d7c90a_.
(The format of our PDB-style files is described here.)

Timeline for d7c90a_: