Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (25 species) not a true protein |
Species Methylophaga aminisulfidivorans [TaxId:1026882] [389919] (1 PDB entry) |
Domain d7c90a_: 7c90 A: [389927] automated match to d2gc7d_ complexed with ca, epe, fe, gol, hec, na |
PDB Entry: 7c90 (more details), 2.13 Å
SCOPe Domain Sequences for d7c90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c90a_ a.3.1.0 (A:) automated matches {Methylophaga aminisulfidivorans [TaxId: 1026882]} qlvfrntvtgdvldlsfgkkgekteavehflntgenlyntddeaikageslfmtacsgch ghhaegklgpalgddyytypknandkglfetiyggarsmmgpqynnltkdeilhimawvr svywgsadkadwlteeqkanfkpaevpedfk
Timeline for d7c90a_: