Lineage for d1rofa_ (1rof A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1413689Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1413784Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 1413799Protein Ferredoxin A [54878] (1 species)
  7. 1413800Species Thermotoga maritima [TaxId:2336] [54879] (2 PDB entries)
  8. 1413802Domain d1rofa_: 1rof A: [38992]
    complexed with sf4

Details for d1rofa_

PDB Entry: 1rof (more details)

PDB Description: nmr study of 4fe-4s ferredoxin of thermatoga maritima
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1rofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rofa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]}
mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisvee

SCOPe Domain Coordinates for d1rofa_:

Click to download the PDB-style file with coordinates for d1rofa_.
(The format of our PDB-style files is described here.)

Timeline for d1rofa_: