Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster |
Protein Ferredoxin A [54878] (1 species) |
Species Thermotoga maritima [TaxId:2336] [54879] (2 PDB entries) |
Domain d1rofa_: 1rof A: [38992] complexed with sf4 |
PDB Entry: 1rof (more details)
SCOPe Domain Sequences for d1rofa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rofa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisvee
Timeline for d1rofa_: