Lineage for d1rof__ (1rof -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32367Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 32432Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (3 proteins)
  6. 32433Protein Ferredoxin [54878] (1 species)
  7. 32434Species Thermotoga maritima [TaxId:243274] [54879] (2 PDB entries)
  8. 32436Domain d1rof__: 1rof - [38992]

Details for d1rof__

PDB Entry: 1rof (more details)

PDB Description: nmr study of 4fe-4s ferredoxin of thermatoga maritima

SCOP Domain Sequences for d1rof__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rof__ d.58.1.4 (-) Ferredoxin {Thermotoga maritima}
mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisvee

SCOP Domain Coordinates for d1rof__:

Click to download the PDB-style file with coordinates for d1rof__.
(The format of our PDB-style files is described here.)

Timeline for d1rof__: