Lineage for d7cefa1 (7cef A:45-304)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900720Family c.69.1.16: Lipase [53555] (2 proteins)
  6. 2900725Protein automated matches [254730] (4 species)
    not a true protein
  7. 2900726Species Saccharomonospora viridis [TaxId:1852] [269028] (11 PDB entries)
  8. 2900734Domain d7cefa1: 7cef A:45-304 [389913]
    Other proteins in same PDB: d7cefa2, d7cefb2
    automated match to d4wfia_
    complexed with ca, zn; mutant

Details for d7cefa1

PDB Entry: 7cef (more details), 1.6 Å

PDB Description: crystal structure of pet-degrading cutinase cut190 /s226p/r228s/ mutant with the c-terminal three residues deletion
PDB Compounds: (A:) Alpha/beta hydrolase family protein

SCOPe Domain Sequences for d7cefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cefa1 c.69.1.16 (A:45-304) automated matches {Saccharomonospora viridis [TaxId: 1852]}
qdnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavavap
gftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvrer
ldpnrlavmghsmggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeldti
apvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtrysq
flcpnptdraieeyrstcpy

SCOPe Domain Coordinates for d7cefa1:

Click to download the PDB-style file with coordinates for d7cefa1.
(The format of our PDB-style files is described here.)

Timeline for d7cefa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7cefa2