Lineage for d1vjwa_ (1vjw A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203903Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
  6. 1203918Protein Ferredoxin A [54878] (1 species)
  7. 1203919Species Thermotoga maritima [TaxId:2336] [54879] (2 PDB entries)
  8. 1203920Domain d1vjwa_: 1vjw A: [38991]
    complexed with sf4

Details for d1vjwa_

PDB Entry: 1vjw (more details), 1.75 Å

PDB Description: structure of oxidoreductase (nadp+(a),ferredoxin(a))
PDB Compounds: (A:) ferredoxin(a)

SCOPe Domain Sequences for d1vjwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]}
mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisve

SCOPe Domain Coordinates for d1vjwa_:

Click to download the PDB-style file with coordinates for d1vjwa_.
(The format of our PDB-style files is described here.)

Timeline for d1vjwa_: