![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) ![]() |
![]() | Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins) |
![]() | Protein Ferredoxin [54878] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [54879] (2 PDB entries) |
![]() | Domain d1vjw__: 1vjw - [38991] |
PDB Entry: 1vjw (more details), 1.75 Å
SCOP Domain Sequences for d1vjw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjw__ d.58.1.4 (-) Ferredoxin {Thermotoga maritima} mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisve
Timeline for d1vjw__: