Lineage for d1bd6a_ (1bd6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949081Protein Ferredoxin [54871] (3 species)
  7. 2949122Species Bacillus schlegelii [TaxId:1484] [54873] (4 PDB entries)
  8. 2949126Domain d1bd6a_: 1bd6 A: [38987]
    complexed with f3s, sf4

Details for d1bd6a_

PDB Entry: 1bd6 (more details)

PDB Description: 7-fe ferredoxin from bacillus schlegelii, nmr, minimized average structure
PDB Compounds: (A:) 7-fe ferredoxin

SCOPe Domain Sequences for d1bd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}
ayvitepcigtkdascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
peewksyiqknrdffkk

SCOPe Domain Coordinates for d1bd6a_:

Click to download the PDB-style file with coordinates for d1bd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bd6a_: