Lineage for d1bc6a_ (1bc6 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650159Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 1650160Protein Ferredoxin [54871] (3 species)
  7. 1650201Species Bacillus schlegelii [TaxId:1484] [54873] (4 PDB entries)
  8. 1650203Domain d1bc6a_: 1bc6 A: [38986]
    complexed with f3s, sf4

Details for d1bc6a_

PDB Entry: 1bc6 (more details)

PDB Description: 7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures
PDB Compounds: (A:) 7-fe ferredoxin

SCOPe Domain Sequences for d1bc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}
ayvitepcigtkdascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
peewksyiqknrdffkk

SCOPe Domain Coordinates for d1bc6a_:

Click to download the PDB-style file with coordinates for d1bc6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bc6a_: