Lineage for d1bc6__ (1bc6 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32367Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 32383Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein)
  6. 32384Protein Ferredoxin [54871] (2 species)
  7. 32423Species Bacillus schlegelii [TaxId:1484] [54873] (4 PDB entries)
  8. 32424Domain d1bc6__: 1bc6 - [38986]

Details for d1bc6__

PDB Entry: 1bc6 (more details)

PDB Description: 7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures

SCOP Domain Sequences for d1bc6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc6__ d.58.1.2 (-) Ferredoxin {Bacillus schlegelii}
ayvitepcigtkdascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
peewksyiqknrdffkk

SCOP Domain Coordinates for d1bc6__:

Click to download the PDB-style file with coordinates for d1bc6__.
(The format of our PDB-style files is described here.)

Timeline for d1bc6__: