Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein) |
Protein Ferredoxin [54871] (2 species) |
Species Bacillus schlegelii [TaxId:1484] [54873] (4 PDB entries) |
Domain d1bc6__: 1bc6 - [38986] |
PDB Entry: 1bc6 (more details)
SCOP Domain Sequences for d1bc6__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bc6__ d.58.1.2 (-) Ferredoxin {Bacillus schlegelii} ayvitepcigtkdascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv peewksyiqknrdffkk
Timeline for d1bc6__: