Lineage for d7c3fm_ (7c3f M:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035134Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 3035135Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) (S)
    automatically mapped to Pfam PF02943
  5. 3035136Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein)
  6. 3035137Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (2 species)
  7. 3035147Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [389795] (3 PDB entries)
  8. 3035154Domain d7c3fm_: 7c3f M: [389835]
    Other proteins in same PDB: d7c3fc_, d7c3ff_, d7c3fi_, d7c3fl_, d7c3fo_, d7c3fr_, d7c3fu_, d7c3fw_
    automated match to d1dj7a_
    complexed with na, sf4

Details for d7c3fm_

PDB Entry: 7c3f (more details), 2.4 Å

PDB Description: crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex
PDB Compounds: (M:) Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic

SCOPe Domain Sequences for d7c3fm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c3fm_ g.36.1.1 (M:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ktepseksveimrkfseqyarrsgtyfcvdkgvtsvvikglaehkdsygaplcpcrhydd
kaaevgqgfwncpcvpmrerkechcmlfltpdndfagkdqtitsdeikettanm

SCOPe Domain Coordinates for d7c3fm_:

Click to download the PDB-style file with coordinates for d7c3fm_.
(The format of our PDB-style files is described here.)

Timeline for d7c3fm_: