Class g: Small proteins [56992] (100 folds) |
Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) automatically mapped to Pfam PF02943 |
Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein) |
Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (2 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [389795] (3 PDB entries) |
Domain d7c3fm_: 7c3f M: [389835] Other proteins in same PDB: d7c3fc_, d7c3ff_, d7c3fi_, d7c3fl_, d7c3fo_, d7c3fr_, d7c3fu_, d7c3fw_ automated match to d1dj7a_ complexed with na, sf4 |
PDB Entry: 7c3f (more details), 2.4 Å
SCOPe Domain Sequences for d7c3fm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c3fm_ g.36.1.1 (M:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ktepseksveimrkfseqyarrsgtyfcvdkgvtsvvikglaehkdsygaplcpcrhydd kaaevgqgfwncpcvpmrerkechcmlfltpdndfagkdqtitsdeikettanm
Timeline for d7c3fm_: