Lineage for d7c3fr_ (7c3f R:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880382Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)
  8. 2880442Domain d7c3fr_: 7c3f R: [389824]
    Other proteins in same PDB: d7c3fa_, d7c3fd_, d7c3fg_, d7c3fj_, d7c3fm_, d7c3fp_, d7c3fs_
    automated match to d3kd0a_
    complexed with na, sf4

Details for d7c3fr_

PDB Entry: 7c3f (more details), 2.4 Å

PDB Description: crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex
PDB Compounds: (R:) Thioredoxin M2, chloroplastic

SCOPe Domain Sequences for d7c3fr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c3fr_ c.47.1.0 (R:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ttdiqvvndstwdslvlkatgpvvvdfwapwcgpskmidplvndlaqhytgkikfyklnt
despntpgqygvrsiptimifvggekkdtiigavpkttltssldkfl

SCOPe Domain Coordinates for d7c3fr_:

Click to download the PDB-style file with coordinates for d7c3fr_.
(The format of our PDB-style files is described here.)

Timeline for d7c3fr_: