Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries) |
Domain d7c3fr_: 7c3f R: [389824] Other proteins in same PDB: d7c3fa_, d7c3fd_, d7c3fg_, d7c3fj_, d7c3fm_, d7c3fp_, d7c3fs_ automated match to d3kd0a_ complexed with na, sf4 |
PDB Entry: 7c3f (more details), 2.4 Å
SCOPe Domain Sequences for d7c3fr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c3fr_ c.47.1.0 (R:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ttdiqvvndstwdslvlkatgpvvvdfwapwcgpskmidplvndlaqhytgkikfyklnt despntpgqygvrsiptimifvggekkdtiigavpkttltssldkfl
Timeline for d7c3fr_: