Lineage for d1frxa_ (1frx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949081Protein Ferredoxin [54871] (3 species)
  7. 2949082Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)
  8. 2949112Domain d1frxa_: 1frx A: [38981]
    complexed with f3s, sf4; mutant

Details for d1frxa_

PDB Entry: 1frx (more details), 2.5 Å

PDB Description: structure and properties of c20s fdi mutant
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1frxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frxa_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevspvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOPe Domain Coordinates for d1frxa_:

Click to download the PDB-style file with coordinates for d1frxa_.
(The format of our PDB-style files is described here.)

Timeline for d1frxa_: