SCOPe 2.07: Domain d7c2fc1: 7c2f C:5-146

Lineage for d7c2fc1 (7c2f C:5-146)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d7c2fc1: 7c2f C:5-146 [389806]
   automated match to d1qz5a1
   complexed with atp, lab, mg

Details for d7c2fc1

PDB Entry: 7c2f, 2.03 Å

PDB Description: crystal structure of the thorarchaeota progel/rabbit actin complex

PDB Compounds: (C:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d7c2fc1:

Sequence, based on SEQRES records:

>d7c2fc1 c.55.1.1 (C:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d7c2fc1 c.55.1.1 (C:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqdsyvgdeaqskrgiltlkypieh
giitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamy
vaiqavlslyasg

Timeline for d7c2fc1:

• d7c2fc1 is new in SCOPe 2.07-stable
  
• d7c2fc1 appears in the current release, SCOPe 2.08