SCOPe 2.07: Domain d7bzba2: 7bzb A:226-554

Lineage for d7bzba2 (7bzb A:226-554)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (45 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279296] (5 PDB entries)

8. Domain d7bzba2: 7bzb A:226-554 [389794]
   Other proteins in same PDB: d7bzba1
   automated match to d3g4da2
   complexed with mg, ppv

Details for d7bzba2

PDB Entry: 7bzb, 2.15 Å

PDB Description: crystal structure of plant sesterterpene synthase attps18

PDB Compounds: (A:) Terpenoid synthase 18

SCOPe Domain Sequences for d7bzba2:

Sequence; same for both SEQRES and ATOM records:

>d7bzba2 a.128.1.0 (A:226-554) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hnkillkfaklnfnfcqfhyiqelktltkwwkdldlasklpyirdrlveshlgglgpyfe
physlgriivakiimtmvvvddtydahatvpevavlteclqrlnigaddklpdylrtvle
svfevmgeieqemrpkgrsygvkqvlerfknvakadkqltewartgdvpsfdeymkvglv
tagmdgyagycfigmedvsekeafewlssnpliiqalnvmfrlandvgtyeteinrgeva
nglncymkqygvtkeeasqelrkiysnnkkvvmeefmnshdhvprqvllrclnfarlfdv
mytegdgysepkgkiehfmtslyvhpipl

Timeline for d7bzba2:

• d7bzba2 is new in SCOPe 2.07-stable
  
• d7bzba2 appears in the current release, SCOPe 2.08