Lineage for d7bzba2 (7bzb A:226-554)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732112Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279296] (5 PDB entries)
  8. 2732113Domain d7bzba2: 7bzb A:226-554 [389794]
    Other proteins in same PDB: d7bzba1
    automated match to d3g4da2
    complexed with mg, ppv

Details for d7bzba2

PDB Entry: 7bzb (more details), 2.15 Å

PDB Description: crystal structure of plant sesterterpene synthase attps18
PDB Compounds: (A:) Terpenoid synthase 18

SCOPe Domain Sequences for d7bzba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bzba2 a.128.1.0 (A:226-554) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hnkillkfaklnfnfcqfhyiqelktltkwwkdldlasklpyirdrlveshlgglgpyfe
physlgriivakiimtmvvvddtydahatvpevavlteclqrlnigaddklpdylrtvle
svfevmgeieqemrpkgrsygvkqvlerfknvakadkqltewartgdvpsfdeymkvglv
tagmdgyagycfigmedvsekeafewlssnpliiqalnvmfrlandvgtyeteinrgeva
nglncymkqygvtkeeasqelrkiysnnkkvvmeefmnshdhvprqvllrclnfarlfdv
mytegdgysepkgkiehfmtslyvhpipl

SCOPe Domain Coordinates for d7bzba2:

Click to download the PDB-style file with coordinates for d7bzba2.
(The format of our PDB-style files is described here.)

Timeline for d7bzba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7bzba1