![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279296] (5 PDB entries) |
![]() | Domain d7bzba2: 7bzb A:226-554 [389794] Other proteins in same PDB: d7bzba1 automated match to d3g4da2 complexed with mg, ppv |
PDB Entry: 7bzb (more details), 2.15 Å
SCOPe Domain Sequences for d7bzba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bzba2 a.128.1.0 (A:226-554) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} hnkillkfaklnfnfcqfhyiqelktltkwwkdldlasklpyirdrlveshlgglgpyfe physlgriivakiimtmvvvddtydahatvpevavlteclqrlnigaddklpdylrtvle svfevmgeieqemrpkgrsygvkqvlerfknvakadkqltewartgdvpsfdeymkvglv tagmdgyagycfigmedvsekeafewlssnpliiqalnvmfrlandvgtyeteinrgeva nglncymkqygvtkeeasqelrkiysnnkkvvmeefmnshdhvprqvllrclnfarlfdv mytegdgysepkgkiehfmtslyvhpipl
Timeline for d7bzba2: