SCOPe 2.08: Domain d7c2ha2: 7c2h A:147-372

Lineage for d7c2ha2 (7c2h A:147-372)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d7c2ha2: 7c2h A:147-372 [389783]
   automated match to d1esva2
   complexed with atp, ca

Details for d7c2ha2

PDB Entry: 7c2h, 2.35 Å

PDB Description: crystal structure of the thorarchaeota 2dgel3/rabbit actin complex

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d7c2ha2:

Sequence; same for both SEQRES and ATOM records:

>d7c2ha2 c.55.1.1 (A:147-372) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

Timeline for d7c2ha2:

• d7c2ha2 first appeared in SCOPe 2.07