Lineage for d7c2gg2 (7c2g G:100-197)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576507Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2576508Protein automated matches [190971] (14 species)
    not a true protein
  7. 2576509Species Candidatus thorarchaeota [TaxId:1706445] [389776] (1 PDB entry)
  8. 2576511Domain d7c2gg2: 7c2g G:100-197 [389778]
    Other proteins in same PDB: d7c2ga1, d7c2ga2
    automated match to d3fg6c3
    complexed with atp, ca

Details for d7c2gg2

PDB Entry: 7c2g (more details), 1.71 Å

PDB Description: crystal structure of the thorarchaeota 2dgel/rabbit actin complex
PDB Compounds: (G:) 2DGel3

SCOPe Domain Sequences for d7c2gg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c2gg2 d.109.1.0 (G:100-197) automated matches {Candidatus thorarchaeota [TaxId: 1706445]}
lrrvqlekreyklwrvhhegddtffaevplsrsslrsddvylvdtwddifvwrgkdasar
ekfdgtmlarrydaervgvqeieliedgsepeefwrsf

SCOPe Domain Coordinates for d7c2gg2:

Click to download the PDB-style file with coordinates for d7c2gg2.
(The format of our PDB-style files is described here.)

Timeline for d7c2gg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7c2gg1