| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
| Protein automated matches [190971] (14 species) not a true protein |
| Species Candidatus thorarchaeota [TaxId:1706445] [389776] (1 PDB entry) |
| Domain d7c2gg2: 7c2g G:100-197 [389778] Other proteins in same PDB: d7c2ga1, d7c2ga2 automated match to d3fg6c3 complexed with atp, ca |
PDB Entry: 7c2g (more details), 1.71 Å
SCOPe Domain Sequences for d7c2gg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c2gg2 d.109.1.0 (G:100-197) automated matches {Candidatus thorarchaeota [TaxId: 1706445]}
lrrvqlekreyklwrvhhegddtffaevplsrsslrsddvylvdtwddifvwrgkdasar
ekfdgtmlarrydaervgvqeieliedgsepeefwrsf
Timeline for d7c2gg2: