SCOPe 2.07: Domain d7c2gg1: 7c2g G:2-99

Lineage for d7c2gg1 (7c2g G:2-99)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (14 species)
   not a true protein

7. Species Candidatus thorarchaeota [TaxId:1706445] [389776] (1 PDB entry)

8. Domain d7c2gg1: 7c2g G:2-99 [389777]
   Other proteins in same PDB: d7c2ga1, d7c2ga2
   automated match to d3fg6a1
   complexed with atp, ca

Details for d7c2gg1

PDB Entry: 7c2g, 1.71 Å

PDB Description: crystal structure of the thorarchaeota 2dgel/rabbit actin complex

PDB Compounds: (G:) 2DGel3

SCOPe Domain Sequences for d7c2gg1:

Sequence; same for both SEQRES and ATOM records:

>d7c2gg1 d.109.1.0 (G:2-99) automated matches {Candidatus thorarchaeota [TaxId: 1706445]}
teptvfhiqkgrlvrmsdpgafgrgdcylvdagpkiylwigpkstadekfltaasavfkd
terkghadidrieggkepeefkvlfddfqltdedtegi

Timeline for d7c2gg1:

• d7c2gg1 is new in SCOPe 2.07-stable
  
• d7c2gg1 appears in the current release, SCOPe 2.08