![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
![]() | Protein Ferredoxin [54871] (3 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries) |
![]() | Domain d1ftca_: 1ftc A: [38974] complexed with f3s, sf4; mutant |
PDB Entry: 1ftc (more details), 2.35 Å
SCOPe Domain Sequences for d1ftca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftca_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} afvvtdncikckctdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Timeline for d1ftca_: