Lineage for d7c0el_ (7c0e L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836044Species Azospirillum brasilense [TaxId:192] [225809] (5 PDB entries)
  8. 2836084Domain d7c0el_: 7c0e L: [389732]
    automated match to d3fkka_
    complexed with ff9

Details for d7c0el_

PDB Entry: 7c0e (more details), 2.2 Å

PDB Description: crystal structure of azospirillum brasilense l-2-keto-3-deoxyarabonate dehydratase (2-oxobutyrate-bound form)
PDB Compounds: (L:) L-2-keto-3-deoxyarabonate dehydratase

SCOPe Domain Sequences for d7c0el_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c0el_ c.1.10.0 (L:) automated matches {Azospirillum brasilense [TaxId: 192]}
rhrgifpvvpttfadtgeldlasqkravdfmidagsdglcilanfseqfaitdderdvlt
rtilehvagrvpvivttshystqvcaarslraqqlgaamvmamppyhgatfrvpeaqife
fyarvsdaiaipimvqdapasgtalsapflarmareieqvayfxietpgaanklrelirl
ggdaiegpwdgeeaitlladlhagatgamtgggfpdgirpileawregrhddayaryqaw
lplinhenrqsgiltakalmreggviaserprhpmpelhpdtraellaiarrldplvlrw
a

SCOPe Domain Coordinates for d7c0el_:

Click to download the PDB-style file with coordinates for d7c0el_.
(The format of our PDB-style files is described here.)

Timeline for d7c0el_: