SCOPe 2.08: Domain d7bzta_: 7bzt A:

Lineage for d7bzta_ (7bzt A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (51 species)
   not a true protein

7. Species Coxsackievirus a10 [TaxId:42769] [359971] (7 PDB entries)

8. Domain d7bzta_: 7bzt A: [389728]
   Other proteins in same PDB: d7bztc_
   automated match to d4cdqa_
   complexed with nag, sph

Details for d7bzta_

PDB Entry: 7bzt, 3 Å

PDB Description: cryo-em structure of mature coxsackievirus a10 in complex with krm1 at ph 7.4

PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d7bzta_:

Sequence; same for both SEQRES and ATOM records:

>d7bzta_ b.121.4.0 (A:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
aesaanttpsshrletgrvpalqaaetgatsnatdenmietrcvvnrngvlettinhffs
rsglvgvvnltdggtdttgyatwdidimgfvqlrrkcemftymrfnaeftfvtttkngea
rpymlqymyvppgapkptgrdafqwqtatnpsvfvkltdppaqvsvpfmspasayqwfyd
gyptfgqhpetsnttyglcpnnmmgtfavrvvsreasqlklqtrvymklkhvrawvprpi
rsqpyllknfpnydsskitnsardrssikqan

Timeline for d7bzta_:

• d7bzta_ first appeared in SCOPe 2.07