Lineage for d7bxza_ (7bxz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968395Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)
  7. 2968396Species Enterococcus faecium [TaxId:1352] [55732] (5 PDB entries)
  8. 2968403Domain d7bxza_: 7bxz A: [389716]
    automated match to d1b87a_

Details for d7bxza_

PDB Entry: 7bxz (more details), 2.5 Å

PDB Description: crystal structure of the aminoglycoside 6'-n-acetyltransferase from enterococcus faecium
PDB Compounds: (A:) aminoglycoside 6'-N-acetyltransferase

SCOPe Domain Sequences for d7bxza_:

Sequence, based on SEQRES records: (download)

>d7bxza_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd

Sequence, based on observed residues (ATOM records): (download)

>d7bxza_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpessaeeveemmnperiavaavdqdelvgfigaip
qygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttlsqtd
lyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd

SCOPe Domain Coordinates for d7bxza_:

Click to download the PDB-style file with coordinates for d7bxza_.
(The format of our PDB-style files is described here.)

Timeline for d7bxza_: