Lineage for d7bzca1 (7bzc A:21-225)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722844Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2722845Protein automated matches [226931] (12 species)
    not a true protein
  7. 2722898Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [389707] (2 PDB entries)
  8. 2722900Domain d7bzca1: 7bzc A:21-225 [389708]
    Other proteins in same PDB: d7bzca2
    automated match to d3g4da1
    complexed with fps, mg

Details for d7bzca1

PDB Entry: 7bzc (more details), 2.3 Å

PDB Description: crystal structure of plant sesterterpene synthase attps18 complexed with farnesyl thiolodiphosphate (fspp)
PDB Compounds: (A:) Terpenoid synthase 18

SCOPe Domain Sequences for d7bzca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bzca1 a.102.4.0 (A:21-225) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
slwgdhflsvsldrgefdelereietmkplvkdmlmssqssdkekirlihllvslgssyh
fdkeiqdilkhsftklddiivgeddletisimfevfrlyghkmscdafdrfrgedgrfke
slakdvrgmlqlfevahlgtpsedimdeassfaqnhldswiggnvsgatphllkhiqnsl
yiprycnievlvareyisyyeqeeg

SCOPe Domain Coordinates for d7bzca1:

Click to download the PDB-style file with coordinates for d7bzca1.
(The format of our PDB-style files is described here.)

Timeline for d7bzca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7bzca2