SCOPe 2.08: Domain d7bzca1: 7bzc A:21-225

Lineage for d7bzca1 (7bzc A:21-225)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [389707] (2 PDB entries)

8. Domain d7bzca1: 7bzc A:21-225 [389708]
   Other proteins in same PDB: d7bzca2
   automated match to d3g4da1
   complexed with fps, mg

Details for d7bzca1

PDB Entry: 7bzc, 2.3 Å

PDB Description: crystal structure of plant sesterterpene synthase attps18 complexed with farnesyl thiolodiphosphate (fspp)

PDB Compounds: (A:) Terpenoid synthase 18

SCOPe Domain Sequences for d7bzca1:

Sequence; same for both SEQRES and ATOM records:

>d7bzca1 a.102.4.0 (A:21-225) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
slwgdhflsvsldrgefdelereietmkplvkdmlmssqssdkekirlihllvslgssyh
fdkeiqdilkhsftklddiivgeddletisimfevfrlyghkmscdafdrfrgedgrfke
slakdvrgmlqlfevahlgtpsedimdeassfaqnhldswiggnvsgatphllkhiqnsl
yiprycnievlvareyisyyeqeeg

Timeline for d7bzca1:

• d7bzca1 first appeared in SCOPe 2.07