![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
![]() | Family h.1.15.0: automated matches [254266] (1 protein) not a true family |
![]() | Protein automated matches [254614] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [270047] (2 PDB entries) |
![]() | Domain d7bv6v_: 7bv6 V: [389705] automated match to d4wy4b_ |
PDB Entry: 7bv6 (more details), 3.05 Å
SCOPe Domain Sequences for d7bv6v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bv6v_ h.1.15.0 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aaeswetleadlielsqlvtdfsllvnsqqekidsiadhvnsaavnveegtknlgkaaky
Timeline for d7bv6v_: