Lineage for d7busa1 (7bus A:1-234)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524267Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2524545Protein automated matches [226868] (6 species)
    not a true protein
  7. 2524575Species Glycine max [TaxId:3847] [389663] (2 PDB entries)
  8. 2524580Domain d7busa1: 7bus A:1-234 [389690]
    Other proteins in same PDB: d7busa3, d7busb3
    automated match to d1cmla1
    complexed with csd

Details for d7busa1

PDB Entry: 7bus (more details), 2.52 Å

PDB Description: chalcone synthase from glycine max (l.) merr (soybean)
PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d7busa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7busa1 c.95.1.2 (A:1-234) automated matches {Glycine max [TaxId: 3847]}
mvsveeirkaqraegpatvmaigtatppncvdqstypdyyfritnsehmtelkekfkrmc
dksmikkrymylneeilkenpsvcaymapsldarqdmvvvevpklgkeaatkaikewgqp
kskithlifcttsgvdmpgadyqltkllglrpsvkrymmyqqgcfaggtvlrlakdlaen
nkgarvlvvcseitavtfrgptdthldslvgqalfgdgaaavivgsdplpvekp

SCOPe Domain Coordinates for d7busa1:

Click to download the PDB-style file with coordinates for d7busa1.
(The format of our PDB-style files is described here.)

Timeline for d7busa1: