Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (2 proteins) has C-terminal extension to the common fold |
Protein Ferredoxin [54871] (3 species) |
Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries) |
Domain d1frj__: 1frj - [38969] complexed with fs3, fs4; mutant |
PDB Entry: 1frj (more details), 2.3 Å
SCOP Domain Sequences for d1frj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frj__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii} afvvtdncikckytdcvevcpvdciyegpnflvihpdecidcalcepecpaqaifsedev pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Timeline for d1frj__: