Lineage for d1frj__ (1frj -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein) Protein Ferredoxin [54871] (2 species) Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries) 
Domain d1frj__: 1frj - [38969]
Details for d1frj__
PDB Entry: 1frj (more details), 2.3 Å
PDB Description: azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
SCOP Domain Sequences for d1frj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frj__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevcpvdciyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
SCOP Domain Coordinates for d1frj__:
Click to download the PDB-style file with coordinates for d1frj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1frj__:
- d1frj__ appears in SCOP 1.57
- d1frj__ appears in the current release, SCOPe 2.08, called d1frja_
View in 3D