SCOPe 2.07: Domain d1frja_: 1frj A:

Lineage for d1frja_ (1frj A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 protein domains)
   has C-terminal extension to the common fold

6. Protein Ferredoxin [54871] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)

8. Domain d1frja_: 1frj A: [38969]
   complexed with f3s, sf4

Details for d1frja_

PDB Entry: 1frj, 2.3 Å

PDB Description: azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1frja_:

Sequence; same for both SEQRES and ATOM records:

>d1frja_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevcpvdciyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

Timeline for d1frja_:

• d1frja_ first appeared (with stable ids) in SCOP 1.55, called d1frj__
  
• d1frja_ appears in SCOPe 2.06