SCOP 1.71: Domain d1fri__: 1fri -

Lineage for d1fri__ (1fri -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (2 proteins)
   has C-terminal extension to the common fold

6. Protein Ferredoxin [54871] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)

8. Domain d1fri__: 1fri - [38964]
   complexed with fs3, fs4; mutant

Details for d1fri__

PDB Entry: 1fri, 2.1 Å

PDB Description: azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential

SCOP Domain Sequences for d1fri__:

Sequence; same for both SEQRES and ATOM records:

>d1fri__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevcpvncfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

Timeline for d1fri__:

• d1fri__ first appeared (with stable ids) in SCOP 1.55
  
• d1fri__ appears in SCOP 1.69
  
• d1fri__ is called d1fria_ in SCOP 1.73
  
• d1fri__ appears in the current release, SCOPe 2.08, called d1fria_