Lineage for d6v65a_ (6v65 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412995Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2413022Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (2 species)
  7. 2413023Species Human (Homo sapiens) [TaxId:9606] [196261] (3 PDB entries)
  8. 2413026Domain d6v65a_: 6v65 A: [389605]
    Other proteins in same PDB: d6v65b_, d6v65c_
    automated match to d1xoda1
    complexed with fmt, gnp, mg, zn

Details for d6v65a_

PDB Entry: 6v65 (more details), 2.76 Å

PDB Description: crystal structure of kras(gmppnp)-nf1(grd)-spred1 complex
PDB Compounds: (A:) Sprouty-related, EVH1 domain-containing protein 1

SCOPe Domain Sequences for d6v65a_:

Sequence, based on SEQRES records: (download)

>d6v65a_ b.55.1.4 (A:) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Human (Homo sapiens) [TaxId: 9606]}
syarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffirgerlrdkmvvl
ecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedis

Sequence, based on observed residues (ATOM records): (download)

>d6v65a_ b.55.1.4 (A:) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Human (Homo sapiens) [TaxId: 9606]}
syarvravvmtrddssggwlplsglssvtvfkvphqeengcadffirgerlrdkmvvlec
mlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedis

SCOPe Domain Coordinates for d6v65a_:

Click to download the PDB-style file with coordinates for d6v65a_.
(The format of our PDB-style files is described here.)

Timeline for d6v65a_: