Lineage for d6zcva_ (6zcv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2809844Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2809845Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2809933Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. 2809934Protein automated matches [227986] (6 species)
    not a true protein
  7. 2809955Species Pseudomonas putida [TaxId:160488] [389591] (2 PDB entries)
  8. 2809957Domain d6zcva_: 6zcv A: [389600]
    automated match to d1eeea_
    complexed with ca, gol, pqq, pr

Details for d6zcva_

PDB Entry: 6zcv (more details), 1.7 Å

PDB Description: crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440
PDB Compounds: (A:) quinoprotein ethanol dehydrogenase

SCOPe Domain Sequences for d6zcva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zcva_ b.70.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
avsneeilqdpknpqqivtnglgvqgqryspldllnvnnvkelrpvwafsfggekqrgqq
aqplikdgvmyltgsysrvfavdartgkklwqydarlpddirpccdvinrgvalygnlvf
fgtldaklvalnkdtgkvvwskkvadhkegysisaapmivngklitgvaggefgvvgkiq
aynpengellwmrptveghmgyvykdgkaiengisggeagktwpgdlwktggaapwlggy
ydpetnlilfgtgnpapwnshlrpgdnlysssrlalnpddgtikwhfqstphdgwdfdgv
nelisfnykdggkevkaaatadrngffyvldrtngkfirgfpfvdkitwatgldkdgrpi
yndasrpgapgseakgssvfvapavlgaknwmpmaynkdtglfyvpsnewgmdiwnegia
ykkgaaflgagftikplnedyigvlraidpvsgkevwrhknyaplwggvlttkgnlvftg
tpegflqafnaktgdkvwefqtgsgvlgspvtwemdgeqyvsvvsgwggavplaggevak
rvkdfnqggmlwtfklpkqlqq

SCOPe Domain Coordinates for d6zcva_:

Click to download the PDB-style file with coordinates for d6zcva_.
(The format of our PDB-style files is described here.)

Timeline for d6zcva_: