Lineage for d1fdda_ (1fdd A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2516579Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2516604Family d.58.1.2: 7-Fe ferredoxin [54870] (3 protein domains)
    has C-terminal extension to the common fold
  6. 2516605Protein Ferredoxin [54871] (3 species)
  7. 2516606Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)
  8. 2516614Domain d1fdda_: 1fdd A: [38960]
    complexed with f3s, sf4

Details for d1fdda_

PDB Entry: 1fdd (more details), 1.9 Å

PDB Description: azotobacter vinelandii ferredoxin i: aspartate 15 facilitates proton transfer to the reduced [3fe-4s] cluster
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1fdda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdda_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytncvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOPe Domain Coordinates for d1fdda_:

Click to download the PDB-style file with coordinates for d1fdda_.
(The format of our PDB-style files is described here.)

Timeline for d1fdda_: