Lineage for d6zcwa_ (6zcw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419317Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2419318Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2419406Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. 2419407Protein automated matches [227986] (5 species)
    not a true protein
  7. 2419423Species Pseudomonas putida [TaxId:160488] [389591] (2 PDB entries)
  8. 2419424Domain d6zcwa_: 6zcw A: [389592]
    automated match to d1eeea_
    complexed with pqq, pr

Details for d6zcwa_

PDB Entry: 6zcw (more details), 1.65 Å

PDB Description: crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440
PDB Compounds: (A:) quinoprotein ethanol dehydrogenase

SCOPe Domain Sequences for d6zcwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zcwa_ b.70.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
avsneeilqdpknpqqivtnglgvqgqryspldllnvnnvkelrpvwafsfggqkqrgqq
aqplikdgvmyltgsysrvfavdartgkklwqydarlpddirpccdvinrgvalygnlvf
fgtldaklvalnkdtgkvvwskkvadhkegysisaapmivngklitgvaggefgvvgkiq
aynpengellwmrptveghmgyvykdgkaiengisggeagktwpgdlwktggaapwlggy
ydpetnlilfgtgnpapwnshlrpgdnlysssrlalnpddgtikwhfqstphdgwdfdgv
nelisfnykdggkevkaaatadrngffyvldrtngkfirgfpfvdkitwatgldkdgrpi
yndasrpgapgseakgssvfvapaflgaknwmpmaynkdtglfyvpsnewgmdiwnegia
ykkgaaflgagftikplnedyigvlraidpvsgkevwrhknyaplwggvlttkgnlvftg
tpegflqafnaktgdkvwefqtgsgvlgspvtwemdgeqyvsvvsgwggavplwggevak
rvkdfnqggmlwtfklpkqlqq

SCOPe Domain Coordinates for d6zcwa_:

Click to download the PDB-style file with coordinates for d6zcwa_.
(The format of our PDB-style files is described here.)

Timeline for d6zcwa_: