SCOPe 2.05: Domain d1f5ca_: 1f5c A:

Lineage for d1f5ca_ (1f5c A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein Ferredoxin [54871] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)

8. Domain d1f5ca_: 1f5c A: [38958]
   complexed with f3s, sf4, so4; mutant

Details for d1f5ca_

PDB Entry: 1f5c, 1.75 Å

PDB Description: crystal structure of f25h ferredoxin 1 mutant from azotobacter vinelandii at 1.75 angstrom resolution

PDB Compounds: (A:) ferredoxin 1

SCOPe Domain Sequences for d1f5ca_:

Sequence; same for both SEQRES and ATOM records:

>d1f5ca_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevcpvdchyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

Timeline for d1f5ca_:

• d1f5ca_ first appeared (with stable ids) in SCOP 1.55
  
• d1f5ca_ appears in SCOPe 2.04
  
• d1f5ca_ appears in SCOPe 2.06
  
• d1f5ca_ appears in the current release, SCOPe 2.08